PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00126371001
Common NameGSBRNA2T00126371001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 382aa    MW: 42161.9 Da    PI: 9.3369
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00126371001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-39119178362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          e+alkcprCdstntkfCy+nny+l+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk+s+
  GSBRNA2T00126371001 119 EAALKCPRCDSTNTKFCYFNNYNLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRSK 178
                          6789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-35102171IPR003851Zinc finger, Dof-type
PfamPF027012.4E-32121176IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.469122176IPR003851Zinc finger, Dof-type
PROSITE patternPS013610124160IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDFSSLPVNQ FDSHNWQQVM NLGYCICFLI RLYFAPNIIN LHIFSLYIFF CLRTTFQSQV  60
VSLKSQGNTL QQDRVTSYQN PNFNLPQFSS PPASQAGSSQ ARVNSMVERA RIAKIPLPEA  120
ALKCPRCDST NTKFCYFNNY NLTQPRHFCK TCRRYWTRGG ALRNVPVGGG FRRNKRSKSN  180
GGGRSKSTVV VSADNNNTSS SLSSNPSYSN PSKFLSYGQA PGFTSNLPIL PPFQSHGGYN  240
SSNIGLDFSG IQMSGMSSSG GMLDPWRMSS LQQSQQFPFL SNTSGLDQSS NALYPLLDGN  300
EGLRSKPLMD MEQPRNMKAE ENDQDLDKDG NGVNNLSRNF LGNININPSG NDEYTSWGGN  360
SSINSSWTGF TSNNSTGHLS F*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00126371001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009139172.10.0PREDICTED: dof zinc finger protein DOF3.6-like
SwissprotQ9M2U11e-158DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A078CH890.0A0A078CH89_BRANA; BnaA04g03660D protein
STRINGBra014752.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.31e-113OBF-binding protein 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]